DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Clec4f

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:254 Identity:53/254 - (20%)
Similarity:108/254 - (42%) Gaps:46/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 TCTEILANEAR-KDQIQLNIQLDALK-----------------ADVSNIKASQLSKDEKLDRMER 104
            |.|:|...:|: |....||.|::.:.                 :|||.:|::.......|.:.:.
  Rat   298 TDTQIQGLKAQLKSTSSLNSQIEVVNGKLKDSSRELQTLRRDLSDVSALKSNVQMLQSNLQKAKA 362

  Fly   105 EQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRY 169
            |..::...||. .:.|..|:...:..|||::..   :.|...|..:....:|.:...::....::
  Rat   363 EVQSLKTGLEA-TKTLAAKIQGQQSDLEALQKA---VAAHTQGQKTQNQVLQLIMQDWKYFNGKF 423

  Fly   170 FYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTG------- 227
            :|...| :.:|.:|:..|...|.||||: |.||..|.:.::.::..:::|:.:....|       
  Rat   424 YYFSRD-KKSWHEAENFCVSQGAHLASV-TSQEEQAFLVQITNAVDHWIGLTDQGTEGNWRWVDG 486

  Fly   228 ---DFVSAASGKSCLYHEWGPGEP----HHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279
               |:|.:.       ..|..|:|    |.|.::|.||. |:::.:...|.....::|:
  Rat   487 TPFDYVQSR-------RFWRKGQPDNWRHGNGEREDCVH-LQRMWNDMACGTAYNWVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/125 (23%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008 19/92 (21%)
CLECT_DC-SIGN_like 414..538 CDD:153060 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.