DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CLEC10A

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_011521915.1 Gene:CLEC10A / 10462 HGNCID:16916 Length:319 Species:Homo sapiens


Alignment Length:325 Identity:62/325 - (19%)
Similarity:113/325 - (34%) Gaps:93/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KIEIQ-----PLP------ALCNGYC--------------------FPTLKPVMEYVAIHQD--- 54
            |:::|     |||      .||:|.|                    |...|...:.|.:..|   
Human    14 KVKVQGFKNGPLPLQSLLQRLCSGPCHLLLSLGLGLLLLVIICVVGFQNSKFQRDLVTLRTDFSN 78

  Fly    55 -KWNTCTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQ------------ 106
             ..||..||.|..::...::..|.  :|||:|...|..:.:...:|.....::            
Human    79 FTSNTVAEIQALTSQGSSLEETIA--SLKAEVEGFKQERQAGVSELQEHTTQKAHLGHCPHCPSV 141

  Fly   107 -FAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQ----CLQPGFEKIG 166
             ..:|..:....:.|...|.:...|:..:.|..:  :|..:|....:|.|:    |         
Human   142 CVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNGE--EASTEGTCCPVNWVEHQDSC--------- 195

  Fly   167 DRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENT---KTGD 228
              |::....  ::|.:|:..|:....||..|.:::| ...|:|...|...::|:::..   |..|
Human   196 --YWFSHSG--MSWAEAEKYCQLKNAHLVVINSREE-QNFVQKYLGSAYTWMGLSDPEGAWKWVD 255

  Fly   229 FVSAASGKSCLYHEWGPGEP-----HHNNDQERCVSILRKLMHVGN------CTYEKRFICQYGI 282
            ....|:|    :..|.||:|     |.....|.|..     .|...      |.....::|:.|:
Human   256 GTDYATG----FQNWKPGQPDDWQGHGLGGGEDCAH-----FHPDGRWNDDVCQRPYHWVCEAGL 311

  Fly   283  282
            Human   312  311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 26/124 (21%)
CLEC10AXP_011521915.1 Lectin_N 18..170 CDD:281887 28/153 (18%)
CLECT_DC-SIGN_like 184..308 CDD:153060 28/146 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.