DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and LOC101886537

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_021327322.1 Gene:LOC101886537 / 101886537 -ID:- Length:284 Species:Danio rerio


Alignment Length:235 Identity:51/235 - (21%)
Similarity:98/235 - (41%) Gaps:59/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LANEARKDQIQLNIQLDALKADVSNIKA--SQLSKD--EKLDRMEREQFAMHESLETINRYLTVK 123
            |.:..:::..||..:|..:..:|:|:.:  :.||.|  |:.||:          :|.:|      
Zfish    85 LLSSNQQEMKQLYGKLTEVGNEVANLTSGFALLSSDQQERNDRL----------MEMVN------ 133

  Fly   124 LDRTKLQLEA-IKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYF----YIEEDVELNWLDA 183
              ..|..||. |.|...|...           ::|      |.|.::|    |:....:|.|..|
Zfish   134 --ELKADLETRIANLTQYKPV-----------LRC------KAGWQHFLSNCYLIPSTKLTWPKA 179

  Fly   184 QAKCRRMGGHLASI-KTKQEFDAIVE-KLDDSKSYFLGVNENTKTGDFVSA----ASGKSCLYH- 241
            ::.|..:...|..: ...:|:|..|: .:..|:||::|:.      |.:::    ..||..:.: 
Zfish   180 RSYCNGIDSLLLILGNDSREWDYFVQYAILTSESYWIGLT------DLITSQWRWIDGKPYVMNS 238

  Fly   242 -EWGPGEPHHNNDQERCVSILRK-LMHVGNCTYEKRFICQ 279
             .|.||||:...::|.|..:... .::...|:...:|||:
Zfish   239 SHWEPGEPNDVLNKEDCGELTASGKLNDAQCSKSFQFICK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 28/124 (23%)
LOC101886537XP_021327322.1 CLECT_DC-SIGN_like 155..279 CDD:153060 31/136 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.