DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and si:ch211-133n4.7

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_017207814.2 Gene:si:ch211-133n4.7 / 101885926 ZFINID:ZDB-GENE-060503-665 Length:208 Species:Danio rerio


Alignment Length:208 Identity:48/208 - (23%)
Similarity:78/208 - (37%) Gaps:58/208 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLNLLLVSHEFSAGTAKIEIQPLPALCNGYCFPTLKPVMEYV-AIHQDKWNTCTEILANEARKD 70
            |:|.:..||..|:.|              |.|..::.    || |:.|....|.|:|:..     
Zfish    45 LLLTVFAVSLVFALG--------------GLCVVSIL----YVRALTQQSAQTNTKIMKR----- 86

  Fly    71 QIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESL---ETINRYLTVKLDRTKLQLE 132
                  ||:.|.|:.|.:|.....||..:..:......:.:.|   :::.:.||....|      
Zfish    87 ------QLEELTANCSRVKDDLYIKDSMMKDLTANYSRVKDDLHIKDSMVKELTANNSR------ 139

  Fly   133 AIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASI 197
             ||....:.||     |.|.|     ...|:  |..||:..:  :|.|..::|.|...|..|.:|
Zfish   140 -IKEQQSFYKA-----FRASN-----MTAFQ--GKLYFFSSD--KLTWSSSRAFCVSRGTDLVTI 189

  Fly   198 KTKQE----FDAI 206
            .::.|    |.|:
Zfish   190 TSRSEQARHFKAV 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 12/42 (29%)
si:ch211-133n4.7XP_017207814.2 Ly49 54..>124 CDD:312037 19/98 (19%)
CLECT 158..>195 CDD:321932 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.