DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and LOC101884526

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_009303560.1 Gene:LOC101884526 / 101884526 -ID:- Length:269 Species:Danio rerio


Alignment Length:192 Identity:45/192 - (23%)
Similarity:86/192 - (44%) Gaps:31/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 EQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKA-------------QMDGYFSAINGVQ 156
            |:|.:..:..| |...|:|..:..|| ..|||..:..||             ::....:.::|.:
Zfish    89 EEFYVKNTNHT-NEIKTLKQIKENLQ-RVIKNLAESNKALKEENPKIHQKVEELRKQINKMDGWR 151

  Fly   157 CLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVN 221
            |.|...      ||...|  :.||.:::..|:..|..|..|::|:|.:.:..::..|.|.::|:.
Zfish   152 CNQSSL------YFISSE--KKNWTESRRDCKERGADLIIIESKEEQEFVEREIGVSDSVWIGLT 208

  Fly   222 ENTKTGDFVSAASGKSCLYHEWGPGEPH--HNNDQERCVSILRKLMHVGN--CTYEKRFICQ 279
            ::...|.: :..:|.|.....||.|||.  ..||::..|::   .:..|:  |....::||:
Zfish   209 DSELEGTW-TWVNGTSLSPGFWGAGEPSGTSTNDEDCAVNL---PLGFGDYPCKNTFKWICE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/115 (25%)
LOC101884526XP_009303560.1 CLECT_DC-SIGN_like 148..267 CDD:153060 32/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.