DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and LOC101884413

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_021327946.1 Gene:LOC101884413 / 101884413 -ID:- Length:292 Species:Danio rerio


Alignment Length:252 Identity:56/252 - (22%)
Similarity:101/252 - (40%) Gaps:49/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CFPTLKPVMEY-VAIHQDKWNTCTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDE---- 97
            ||..|..||.. |.|:.:..|...|       :.|:..||              :.|::|.    
Zfish    75 CFLLLTVVMVLSVIIYTNNTNYTEE-------RHQLLTNI--------------TNLTEDRDTLL 118

  Fly    98 -KLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPG 161
             |:..:..:|..:|..    |..||.:.|      |.:.|..|.:| |.|......|.:..::..
Zfish   119 TKITNLTEDQNQLHAK----NIRLTQEKD------ELLSNEQDLIK-QRDHLNQEKNELLKMEWI 172

  Fly   162 FEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKT 226
            :.:....||:   .::.:|.:::..||..|..|..|..::|.| .|:|:...:..::|::::...
Zfish   173 YYRSNLYYFF---KLKKSWTESRRYCRNHGADLVIINNREEQD-FVDKITAGEKAWIGLSDSDVE 233

  Fly   227 GD--FVSAASGKSCLYHEWGPGEPHHNNDQ--ERCVSILRKLMHVGNCTYEKRFICQ 279
            |.  :|..:...|.::|.   |||.....|  |.||..:........|..|.::||:
Zfish   234 GSWKWVDDSKPTSWIWHY---GEPSSGGGQVEEDCVLTVTSAWADYPCDAEFQWICE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 28/115 (24%)
LOC101884413XP_021327946.1 SH3_and_anchor <97..174 CDD:275056 20/108 (19%)
CLECT_DC-SIGN_like 170..288 CDD:153060 28/125 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.