DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and asgrl2

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_005170656.1 Gene:asgrl2 / 101882127 ZFINID:ZDB-GENE-080917-52 Length:299 Species:Danio rerio


Alignment Length:301 Identity:62/301 - (20%)
Similarity:109/301 - (36%) Gaps:94/301 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVLVLNLLL------VSH-----EFSAGTAKIEIQPLPALCNGYCFPTLKPVMEYVAIHQDKWNT 58
            ||..|.|||      |:|     :|||  .::.||.|                            
Zfish    61 SVAALMLLLLIITVSVNHVKFNRKFSA--TEVRIQNL---------------------------- 95

  Fly    59 CTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLTVK 123
             |:|:.|...:.| :|......:.||||:::..|...:..::.:.....|:|:           |
Zfish    96 -TQIILNVISRTQ-ELEQFGHKINADVSSLEFDQRMTETSMNNLLESAQALHD-----------K 147

  Fly   124 LDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQ--CLQPGFEKIGDRYFYIEEDVELNWLDAQAK 186
            :...|..::.::|                |..|  |....:.......::...| .::|..|:.:
Zfish   148 VSELKCHIDKMRN----------------NNTQELCCPDQWSLFSSNCYFFSTD-GMSWDSARDE 195

  Fly   187 CRRMGGHLASIKTKQEFDAIVEKLDDSKS--YFLGVNENTKTGDFV-SAASGKSCLYHEWGPGEP 248
            |.|....|..:.:|.|...:|.|   :|.  |:||:.:. :||::. ...:....:..||.||:|
Zfish   196 CERKRAKLLILTSKLEKSFVVSK---TKPLFYWLGLTDG-RTGEWEWLDETPYEMVRSEWRPGQP 256

  Fly   249 -----HHNNDQERCVSILRKLMHVG-----NCTYEKRFICQ 279
                 |.....|.|.    ...|.|     :|:...|:||:
Zfish   257 DNWKAHGLGGGEDCA----HFHHDGRYNDDHCSRHYRYICK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 30/124 (24%)
asgrl2XP_005170656.1 zf-C4H2 <108..>165 CDD:313386 12/83 (14%)
CLECT_DC-SIGN_like 168..293 CDD:153060 29/133 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.