DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CLEC3A

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_005743.5 Gene:CLEC3A / 10143 HGNCID:2052 Length:197 Species:Homo sapiens


Alignment Length:188 Identity:38/188 - (20%)
Similarity:80/188 - (42%) Gaps:30/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LTVKLDRT----------KLQLEAIKNTMDYMKAQMDGYFSAINGVQ--------CLQPGFEKIG 166
            :|:.||:|          |.....:::....:|.|::..::.:|.::        ||:.  .|:.
Human    13 ITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRG--TKVH 75

  Fly   167 DRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVE----KLDDSKSYFLGVNENTKTG 227
            .:.:...|.:: ::.:|...|...||.|...:...|.:|:.:    .|.....::||:|:....|
Human    76 KKCYLASEGLK-HFHEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEG 139

  Fly   228 DFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGN---CTYEKRFICQYGI 282
            .||. .:|.:..:..|...:| :...:|.||...:......:   |...||:||::.|
Human   140 KFVD-VNGIAISFLNWDRAQP-NGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFTI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 26/117 (22%)
CLEC3ANP_005743.5 CLECT_tetranectin_like 68..193 CDD:153066 29/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.