DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and colec11

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_004914539.1 Gene:colec11 / 100493760 XenbaseID:XB-GENE-952506 Length:277 Species:Xenopus tropicalis


Alignment Length:119 Identity:30/119 - (25%)
Similarity:57/119 - (47%) Gaps:13/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 YFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDS--KSYFLGVNENTKTGDFVS 231
            |..::|  |..::|||..|:..||.|:..|.:.....|...::.:  ...|:|:|:..:.|.||.
 Frog   160 YLLVKE--EKKYIDAQDYCQGRGGTLSMPKDETTNSLIASYINQAGLSRVFIGINDLEREGHFVY 222

  Fly   232 AASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVG-----NCTYEKRFICQY 280
            :.......:::|..|||::..|:|.|.    :::..|     :|.....|||::
 Frog   223 SDRSPMQTFNKWRQGEPNNAYDEEDCA----EMVSSGGWNDVSCLITMYFICEF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 30/117 (26%)
colec11XP_004914539.1 Collagen <40..80 CDD:460189
CLECT_collectin_like 158..272 CDD:153061 30/117 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.