DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and cd209

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001186302.2 Gene:cd209 / 100334918 ZFINID:ZDB-GENE-061207-22 Length:343 Species:Danio rerio


Alignment Length:240 Identity:61/240 - (25%)
Similarity:99/240 - (41%) Gaps:50/240 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TEILANEARKDQIQLNI-----QLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETI--- 116
            |.|.:....:||:..||     :...|.|..:|:|   :.||::|..|:    ||.:.||.|   
Zfish   127 TRITSLTEERDQLLTNITNLTEEKAKLLASNTNLK---VEKDQQLKMMK----AMKDQLENIIKN 184

  Fly   117 ----NRYLTVK---LDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEE 174
                |:..:.|   |.:...||:..|..::....:.|.:|       ..|..|      ||...|
Zfish   185 LLKENKQFSSKNEDLLKQSAQLKKEKKDLEKRLHEQDSWF-------YFQSSF------YFISSE 236

  Fly   175 DVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENT---KTGDFVSAASGK 236
              |.||.:::..||..|..|..|..::|.|. |:|:....:.::|:.::.   |..|..:..:| 
Zfish   237 --ERNWTESRRYCRDKGADLIIINNREEQDH-VKKMSGGFTVWIGLTDSDDRWKWIDGTNMTTG- 297

  Fly   237 SCLYHEWGPGEPHHNNDQ--ERCVSILRKLMHVGNCTYEKRFICQ 279
               :..|..|||   |.|  |.||:..........|.|...:||:
Zfish   298 ---FRFWNHGEP---NGQGGENCVTSRSSGWADYPCFYPFPWICE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 32/116 (28%)
cd209NP_001186302.2 DivIC 94..183 CDD:299713 19/62 (31%)
CLECT_DC-SIGN_like 220..337 CDD:153060 36/140 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.