DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and si:ch73-343l4.8

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_002660625.1 Gene:si:ch73-343l4.8 / 100320176 ZFINID:ZDB-GENE-090313-159 Length:170 Species:Danio rerio


Alignment Length:174 Identity:39/174 - (22%)
Similarity:72/174 - (41%) Gaps:38/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 EAIKNTMDYMKAQMDG-----YFSAINGVQCL-----------QPGFEKIGDRYFYIEEDVELNW 180
            |.:::..|..|||.:.     ..:.|.|..|:           :.|..::|  .|:|..:. ::|
Zfish     8 ENVEDVKDEGKAQQNRRSCLMLATVILGTICVILLVFVILQHTRAGSNRLG--LFFISNNT-MSW 69

  Fly   181 LDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNE-----NTKTGDFVSAASGKSCLY 240
            .:::..||..|..|..|.|:::...|...::|  ..::|:.:     |.|..|......|     
Zfish    70 SESRQFCRDRGADLVIINTEEKQRFISPFVED--FLWIGLTDEEIEGNMKWVDNSPLKQG----- 127

  Fly   241 HEWGPGEPHHNNDQERCVSILRKLMHVGN-----CTYEKRFICQ 279
             .|..|||::.|. |.||.|:.....:.|     ||:..:.:|:
Zfish   128 -FWVDGEPNNLNG-ENCVIIVPVENFLKNWNDVPCTFTFKALCE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/121 (24%)
si:ch73-343l4.8XP_002660625.1 CLECT_DC-SIGN_like 48..170 CDD:153060 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.