DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and hbl1

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_009296948.2 Gene:hbl1 / 100007982 ZFINID:ZDB-GENE-070912-285 Length:297 Species:Danio rerio


Alignment Length:158 Identity:41/158 - (25%)
Similarity:69/158 - (43%) Gaps:14/158 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLA 195
            :|::|:.:..:||::|....|.:     ...|.|:|.:| |:.:.:...:.:....|....|.|.
Zfish   147 IESLKSEIQNLKAKIDTIEKAAS-----FSNFRKVGQKY-YVTDRIFGTFDNGIKLCESSSGTLV 205

  Fly   196 SIKTKQEFDAIV-----EKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQE 255
            ..|:..|..|:|     ..|.:.|.| :||.:....|.||. ..||...:.:||||:|......:
Zfish   206 VPKSSAENQALVRVAASSGLINEKPY-IGVTDKETEGQFVD-IEGKQLTFTKWGPGQPDDYQGAQ 268

  Fly   256 RC-VSILRKLMHVGNCTYEKRFICQYGI 282
            .| |..:......|||...:..||:..|
Zfish   269 DCGVIDVSGTWDDGNCGDIRPIICEIDI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 31/116 (27%)
hbl1XP_009296948.2 CLECT 178..294 CDD:321932 31/118 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10963
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.