DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and colec10

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001276917.1 Gene:colec10 / 794040 ZFINID:ZDB-GENE-131127-525 Length:271 Species:Danio rerio


Alignment Length:195 Identity:37/195 - (18%)
Similarity:64/195 - (32%) Gaps:68/195 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 WKKIIAEDIENRTNRSELKMEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIV 157
            ::|:|.:            |:..:|.::.|:..|...:..:....|:.         ||.:.:  
Zfish   113 YRKVIGQ------------MDASISKVKNAIKFIKKVVLGIRETENMF---------YLLVTE-- 154

  Fly   158 QQNWTSALSACQKMGGN------------LASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVF 210
            .:.:..:|..|:..||.            ||:.|.|||.|                      .||
Zfish   155 ARTYQQSLLNCKLRGGTLAMSRTEEKNNLLANFIKEADLN----------------------HVF 197

  Fly   211 ISVSSGKRAPFLKWNPGEPL-------YEHVDQ---RCVSI-HNGGMWVASCTSDFKYICEANEN 264
            |.:.:|.......:..|.||       .:..|.   .||.: ..|.:....|.:...||||..:|
Zfish   198 IRLQAGVTEVGYMYLNGNPLLNTTAWAIQGADSGKGDCVQLGRTGALSQVDCGATQYYICEFVKN 262

  Fly   265  264
            Zfish   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 6/40 (15%)
CLECT 160..260 CDD:153057 25/122 (20%)
colec10NP_001276917.1 Collagen 54..106 CDD:189968
CLECT 148..259 CDD:295302 28/143 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.