Sequence 1: | NP_001285727.1 | Gene: | lectin-28C / 53542 | FlyBaseID: | FBgn0040099 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276917.1 | Gene: | colec10 / 794040 | ZFINID: | ZDB-GENE-131127-525 | Length: | 271 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 37/195 - (18%) |
---|---|---|---|
Similarity: | 64/195 - (32%) | Gaps: | 68/195 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 WKKIIAEDIENRTNRSELKMEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIV 157
Fly 158 QQNWTSALSACQKMGGN------------LASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVF 210
Fly 211 ISVSSGKRAPFLKWNPGEPL-------YEHVDQ---RCVSI-HNGGMWVASCTSDFKYICEANEN 264
Fly 265 264 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-28C | NP_001285727.1 | Mer2 | <12..134 | CDD:286200 | 6/40 (15%) |
CLECT | 160..260 | CDD:153057 | 25/122 (20%) | ||
colec10 | NP_001276917.1 | Collagen | 54..106 | CDD:189968 | |
CLECT | 148..259 | CDD:295302 | 28/143 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 76 | 1.000 | Inparanoid score | I5252 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.050 |