DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and COLEC11

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001242914.1 Gene:COLEC11 / 78989 HGNCID:17213 Length:285 Species:Homo sapiens


Alignment Length:30 Identity:10/30 - (33%)
Similarity:15/30 - (50%) Gaps:3/30 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FIAIAVLALATVSQGSYLPAVQS---VLPY 30
            |.|:.||.|.|..:....|.|::   :|.|
Human   554 FSALTVLVLVTFVKYKDTPIVKANNRILSY 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474 4/14 (29%)
CLECT 160..260 CDD:153057
COLEC11NP_001242914.1 Collagen 61..112 CDD:460189
CLECT_collectin_like 165..280 CDD:153061
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.