DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and lectin-22C

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:249 Identity:86/249 - (34%)
Similarity:139/249 - (55%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ETDRVVCQLEDPRNQCGPFCLEALMPLIGHIAQHQ---EQWKTCKLQEIQAQQRDIEKEIE---- 83
            |:| |:|.|:||.:|||.|||..|.|::.|:...|   ....:.|..|:..:|..:|.::.    
  Fly    23 ESD-VICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANEVLVRQYTMEGQLTALQN 86

  Fly    84 ---SQKTSLTESWKKIIAEDIENRTNRSELKMEGQLSDLQEALTSITTSLKNMSAKINILHRFKR 145
               |.:.:|....:|:...: :|.|.|... |||.||.|::.:..:.|.:|.:.        |::
  Fly    87 KQLSIEVALDAQGRKLNVNE-QNFTERLNC-MEGILSALEKTVLEVKTKIKYLG--------FEQ 141

  Fly   146 IGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVF 210
            |||:|.:||.:.::||::|...|:.|||:||.|.:|||..||.:.|.:|..|.:||:||..:|.|
  Fly   142 IGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKF 206

  Fly   211 ISVSSGKRAPFLKWNPGEPLYEHVDQ-RCVSIHNGGMWVASCTSDFKYICEANE 263
            :|:.:||:..||||..|.|  ..:|. .||.::||.|:...|...|::||:..|
  Fly   207 LSMPTGKQTTFLKWASGRP--SQLDTLNCVFLYNGEMYDYPCHYTFRFICQTEE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 35/117 (30%)
CLECT 160..260 CDD:153057 42/100 (42%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 45/110 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.