Sequence 1: | NP_001285727.1 | Gene: | lectin-28C / 53542 | FlyBaseID: | FBgn0040099 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001087239.2 | Gene: | SFTPA1 / 653509 | HGNCID: | 10798 | Length: | 263 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 45/199 - (22%) |
---|---|---|---|
Similarity: | 68/199 - (34%) | Gaps: | 63/199 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 QEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQLSDLQEAL-----TSITT 128
Fly 129 SLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQLSK 193
Fly 194 DNTY-MIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSIHNGGMW-VASCTSDFK 256
Fly 257 YICE 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-28C | NP_001285727.1 | Mer2 | <12..134 | CDD:286200 | 12/69 (17%) |
CLECT | 160..260 | CDD:153057 | 29/101 (29%) | ||
SFTPA1 | NP_001087239.2 | Collagen | 43..115 | CDD:189968 | |
CLECT_collectin_like | 151..263 | CDD:153061 | 37/147 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 72 | 1.000 | Inparanoid score | I5300 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R8166 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.080 |