DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and SFTPA1

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_054222603.1 Gene:SFTPA1 / 653509 HGNCID:10798 Length:276 Species:Homo sapiens


Alignment Length:199 Identity:45/199 - (22%)
Similarity:68/199 - (34%) Gaps:63/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQLSDLQEAL-----TSITT 128
            :|:||...|...:|                     ...|..|.::|.:..:.|.:     .|||.
Human   133 EELQATLHDFRHQI---------------------LQTRGALSLQGSIMTVGEKVFSSNGQSITF 176

  Fly   129 SLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQLSK 193
                                      |.:|:       ||.:.||.:|...|..:..||.|.:.|
Human   177 --------------------------DAIQE-------ACARAGGRIAVPRNPEENEAIASFVKK 208

  Fly   194 DNTY-MIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSIHNGGMW-VASCTSDFK 256
            .||| .:|:::....|.| ..|.|....:..|..|||.....:| ||.::..|.| ..:|.....
Human   209 YNTYAYVGLTEGPSPGDF-RYSDGTPVNYTNWYRGEPAGRGKEQ-CVEMYTDGQWNDRNCLYSRL 271

  Fly   257 YICE 260
            .|||
Human   272 TICE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474 14/95 (15%)
CLECT 160..260 CDD:153057 29/101 (29%)
SFTPA1XP_054222603.1 Collagen 56..128 CDD:460189
CLECT_collectin_like 164..276 CDD:153061 37/147 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.