DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and SFTPA1

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001087239.2 Gene:SFTPA1 / 653509 HGNCID:10798 Length:263 Species:Homo sapiens


Alignment Length:199 Identity:45/199 - (22%)
Similarity:68/199 - (34%) Gaps:63/199 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQLSDLQEAL-----TSITT 128
            :|:||...|...:|                     ...|..|.::|.:..:.|.:     .|||.
Human   120 EELQATLHDFRHQI---------------------LQTRGALSLQGSIMTVGEKVFSSNGQSITF 163

  Fly   129 SLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQLSK 193
                                      |.:|:       ||.:.||.:|...|..:..||.|.:.|
Human   164 --------------------------DAIQE-------ACARAGGRIAVPRNPEENEAIASFVKK 195

  Fly   194 DNTY-MIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSIHNGGMW-VASCTSDFK 256
            .||| .:|:::....|.| ..|.|....:..|..|||.....:| ||.::..|.| ..:|.....
Human   196 YNTYAYVGLTEGPSPGDF-RYSDGTPVNYTNWYRGEPAGRGKEQ-CVEMYTDGQWNDRNCLYSRL 258

  Fly   257 YICE 260
            .|||
Human   259 TICE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 12/69 (17%)
CLECT 160..260 CDD:153057 29/101 (29%)
SFTPA1NP_001087239.2 Collagen 43..115 CDD:189968
CLECT_collectin_like 151..263 CDD:153061 37/147 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8166
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.080

Return to query results.
Submit another query.