DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and clec11a

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_696773.2 Gene:clec11a / 568355 ZFINID:ZDB-GENE-130530-861 Length:273 Species:Danio rerio


Alignment Length:168 Identity:34/168 - (20%)
Similarity:72/168 - (42%) Gaps:26/168 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMEGQLSDLQEALTSITTSLKNMSAKINIL---HRFKRIGSRYLHIEDIVQQNWTSALSACQKMG 172
            :::.:|.|.::|:..:::..|:...:|..|   .:.::||.:.: :...|.:.:..|...||:.|
Zfish   111 RLDNRLGDTEDAIQQVSSYCKDNRKEIGRLEGCQKGRKIGYKCV-LAYRVYETYADASKKCQERG 174

  Fly   173 GNLASIINEADFNAI---VSQLSKDN-TYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEH 233
            |.:|...:..:..|:   |..:...| ...:||:|...:|::: .....|..:.:|.      :|
Zfish   175 GRMAMPRDRKEQEALAEYVKSVFHGNWPVWLGINDERSEGLYL-FEDTTRVTYFQWR------KH 232

  Fly   234 V---------DQRCV--SIHNGGMWVASCTSDFKYICE 260
            .         .:.||  |..:|..|...|.....|:||
Zfish   233 FLSSQPDGGKRENCVAMSSDDGDWWDTYCERRMYYLCE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 4/22 (18%)
CLECT 160..260 CDD:153057 23/114 (20%)
clec11aXP_696773.2 CLECT 143..271 CDD:295302 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.