DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and hbl2

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_009296949.2 Gene:hbl2 / 566971 ZFINID:ZDB-GENE-070912-286 Length:253 Species:Danio rerio


Alignment Length:153 Identity:42/153 - (27%)
Similarity:72/153 - (47%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 QEALTSITTSLKNMSAKINILHR------FKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASI 178
            :..:.|:.:.::|:.|:|:.:.:      |:|:|.:| ::.|.:..|:...:..|:..||.|...
Zfish   101 ESVIESLKSEIQNLKAEIDTIEKAASFSNFRRVGQKY-YVTDGILGNFNDGIKFCKDAGGTLVVP 164

  Fly   179 INEADFNAIV-----SQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRC 238
            ...|:..|:|     |.||....| ||::|...:|.|:.: .||:..|..|.||:|......|.|
Zfish   165 KTAAENQALVRVSVSSALSTGKPY-IGVTDRETEGQFVDI-EGKQLTFTNWGPGQPDDYRGGQDC 227

  Fly   239 VSIHNGGMWVASCTSDFK-YICE 260
            ..|...|.|......|.: .|||
Zfish   228 GVIEVSGTWDDGNCGDIRPIICE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 2/13 (15%)
CLECT 160..260 CDD:153057 31/105 (30%)
hbl2XP_009296949.2 Collagen <36..70 CDD:189968
CLECT_collectin_like 135..251 CDD:153061 35/119 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8166
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.