DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and lectin-24A

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster


Alignment Length:286 Identity:79/286 - (27%)
Similarity:150/286 - (52%) Gaps:33/286 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFQLKVLLYYAIIAIVINASPSGCEETDRVVCQLEDPRNQCGPFCLEALMPLIGHIAQHQEQWKT 65
            ||:|.||:..  :.:|.:...:|   |.::  :::.....|..:|...|.|::.::|.||::|.|
  Fly     1 MFRLSVLVLN--LLLVSHEFSAG---TAKI--EIQPLPALCNGYCFPTLKPVMEYVAIHQDKWNT 58

  Fly    66 CK---LQEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIE-NRTNRSELKMEGQLSDLQEALT-- 124
            |.   ..|.:..|..:..::::.|..::......:::|.: :|..|.:..|...|..:...||  
  Fly    59 CTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLTVK 123

  Fly   125 ---------SITTSLKNMSAKIN-----------ILHRFKRIGSRYLHIEDIVQQNWTSALSACQ 169
                     :|..::..|.|:::           :...|::||.||.:||:.|:.||..|.:.|:
  Fly   124 LDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCR 188

  Fly   170 KMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHV 234
            :|||:||||..:.:|:|||.:|....:|.:|:::..:.|.|:|.:|||...:.:|.||||.:.:.
  Fly   189 RMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNND 253

  Fly   235 DQRCVSIHNGGMWVASCTSDFKYICE 260
            .:|||||....|.|.:||.:.::||:
  Fly   254 QERCVSILRKLMHVGNCTYEKRFICQ 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 24/136 (18%)
CLECT 160..260 CDD:153057 39/99 (39%)
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 44/111 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.