DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and lectin-30A

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:227 Identity:64/227 - (28%)
Similarity:112/227 - (49%) Gaps:48/227 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LIGHIAQHQEQWKT-CKLQEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQ 115
            ||..:|.:|:||.| ..|:|.:.||:.:.                 |...||.|....:.|:...
  Fly    28 LIDQVAINQQQWFTFIALKESEMQQKIVR-----------------IERSIEERLMAMQSKLAYA 75

  Fly   116 LSDLQEALTSITTSLKNMSA----KINILHR-----FKRIGSRYLHIEDIVQQNWTSALSACQKM 171
            |::||       |.:.|.|.    |:.|.||     |:|:|:|..:||...:|||..|.:.|:::
  Fly    76 LNELQ-------TIMGNQSVETLEKLRISHRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQL 133

  Fly   172 GGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQ 236
            ||::|:|.:|.:||.|.|: :....:.|.::.:.:.|:|.|..:|:..||.||..        ::
  Fly   134 GGHIATIRDEQEFNEIFSR-APAGVFWIDMNAMFKNGLFASSLTGRSPPFFKWKK--------EE 189

  Fly   237 R-----CVSIHNGGMWVASCTSDFKYICEANE 263
            |     ||:::|..|:..:|.:...:||:|.:
  Fly   190 RGNKFDCVNVYNKEMYNENCFNTHLFICQAEQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 21/82 (26%)
CLECT 160..260 CDD:153057 29/104 (28%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 30/108 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12161
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.