DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and CLEC4A

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:118 Identity:25/118 - (21%)
Similarity:48/118 - (40%) Gaps:29/118 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 NWTSALSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKR------ 218
            :|..:...|.:|..:|..|..:.:.:.|...|.:::.|.:|:||          ..|:|      
Human   126 SWQDSEKDCARMEAHLLVINTQEEQDFIFQNLQEESAYFVGLSD----------PEGQRHWQWVD 180

  Fly   219 -APFLK----WNPGEPLYEHVDQRCVSIH------NGGMWVASCTSDFKYICE 260
             .|:.:    |:|.||  ...::|||.::      ..|....:|....:.:||
Human   181 QTPYNESSTFWHPREP--SDPNERCVVLNFRKSPKRWGWNDVNCLGPQRSVCE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474 25/118 (21%)
CLECT 160..260 CDD:153057 23/116 (20%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 25/118 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.