Sequence 1: | NP_001285727.1 | Gene: | lectin-28C / 53542 | FlyBaseID: | FBgn0040099 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001166857.1 | Gene: | Clec7a / 502902 | RGDID: | 1565140 | Length: | 235 | Species: | Rattus norvegicus |
Alignment Length: | 237 | Identity: | 47/237 - (19%) |
---|---|---|---|
Similarity: | 83/237 - (35%) | Gaps: | 70/237 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 RDIEKE-IESQKTSLTES--WKKIIA------------------------------EDIENRTNR 107
Fly 108 SELKMEGQLSDLQEAL----TSITTSLKNMSAKIN-ILHRFKRIGSRYLHIEDIVQQNWTSALSA 167
Fly 168 CQKMGGNLASIINEADFNAIVSQLS--KDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPL 230
Fly 231 ------------YEHVDQRCVSIHNGGMWVASCTSDFKYICE 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-28C | NP_001285727.1 | Mer2 | <12..134 | CDD:286200 | 17/94 (18%) |
CLECT | 160..260 | CDD:153057 | 25/113 (22%) | ||
Clec7a | NP_001166857.1 | Ly49 | 34..>61 | CDD:400616 | 2/26 (8%) |
CLECT_NK_receptors_like | 110..233 | CDD:153063 | 30/141 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |