DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Clec7a

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001166857.1 Gene:Clec7a / 502902 RGDID:1565140 Length:235 Species:Rattus norvegicus


Alignment Length:237 Identity:47/237 - (19%)
Similarity:83/237 - (35%) Gaps:70/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RDIEKE-IESQKTSLTES--WKKIIA------------------------------EDIENRTNR 107
            |:|.|. ::|:|.|...|  |:.|..                              |:.:|..:|
  Rat    14 RNIHKRPVKSEKGSPAPSSRWRSIAVALGILCLLTVVVAAVLGALAFRRFNSGRYPEEKDNFPSR 78

  Fly   108 SELKMEGQLSDLQEAL----TSITTSLKNMSAKIN-ILHRFKRIGSRYLHIEDIVQQNWTSALSA 167
            ::...:.....|.|.:    .|.||.:.:.....| |:|      ::..::....:.:|..:...
  Rat    79 NKENHKPTEPSLDEKVAPSKASQTTGVFSGPCLPNWIMH------AKSCYLFSFSENSWYGSRRH 137

  Fly   168 CQKMGGNLASIINEADFNAIVSQLS--KDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPL 230
            |.::|.:|..|.|..:|..|.||.|  :.|::.||:|....:|.:.            |..|...
  Rat   138 CSQLGAHLLKIDNAKEFEFIESQTSSHRVNSFWIGLSRNQSEGPWF------------WEDGSAF 190

  Fly   231 ------------YEHVDQRCVSIHNGGMWVASCTSDFKYICE 260
                        .|.:...||.||...::...|.:....|||
  Rat   191 TPNSFQVRNTAPQESLPHNCVWIHGSEVYNQMCIASSFTICE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 17/94 (18%)
CLECT 160..260 CDD:153057 25/113 (22%)
Clec7aNP_001166857.1 Ly49 34..>61 CDD:400616 2/26 (8%)
CLECT_NK_receptors_like 110..233 CDD:153063 30/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.