DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and colec10

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011227.1 Gene:colec10 / 496663 XenbaseID:XB-GENE-945586 Length:275 Species:Xenopus tropicalis


Alignment Length:153 Identity:40/153 - (26%)
Similarity:73/153 - (47%) Gaps:10/153 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNL 175
            |:.||| |:..|  .:.:|||.:.   |::...:....:|.:|.. .::|:..||:.|:..||.|
 Frog   124 KVVGQL-DVNVA--HLKSSLKFVK---NVIAGIRETDEKYYYIVR-EERNYRDALTQCRIRGGTL 181

  Fly   176 ASIINEADFNAIVSQLSKDNTY--MIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRC 238
            |...::|..:.|...:||...:  .|||:|:.::..|:...:.....:..|..|||......:.|
 Frog   182 AMPKDQATNSLIADYISKMGLFRVFIGINDIEKEKQFVYADNSPLQTYSSWKAGEPNDGSGYEDC 246

  Fly   239 VSIHNGGMW-VASCTSDFKYICE 260
            |.:.:.|.| ...|:....::||
 Frog   247 VEMLSTGHWNDVDCSLTIYFVCE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474 12/48 (25%)
CLECT 160..260 CDD:153057 26/102 (25%)
colec10NP_001011227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..76
gly_rich_SclB <45..>99 CDD:468478
CLECT_collectin_like 155..270 CDD:153061 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.