DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and colec11

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001007332.1 Gene:colec11 / 492459 ZFINID:ZDB-GENE-041114-11 Length:271 Species:Danio rerio


Alignment Length:159 Identity:46/159 - (28%)
Similarity:78/159 - (49%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSR-YLHIEDIVQQNWTSALSACQKMGGN 174
            ||.|:: |:|  :..:|..||.:.   |.:...|...|: ||.:::  ::.:..|...||..||:
Zfish   120 KMIGEM-DIQ--VVQLTNELKFIK---NAVAGIKETDSKVYLLVKE--EKRYREAEVFCQGRGGH 176

  Fly   175 LASIINEADFNAI---VSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQ 236
            ||...:.|...||   |:.......| |||:||..:|.|:.|.......|.:|..|||...:.|:
Zfish   177 LAMPKDAAANRAIAGYVTDAGLSRVY-IGINDLEREGHFVYVERSPMTTFSRWREGEPNNAYDDE 240

  Fly   237 RCVSIHNGGMWV-ASCTSDFKYICEANEN 264
            .||.:.:.|.|: .:|.....::||.:::
Zfish   241 DCVEMVSSGEWIDVACQLTMYFVCEFDKD 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474 13/49 (27%)
CLECT 160..260 CDD:153057 31/103 (30%)
colec11NP_001007332.1 gly_rich_SclB <40..>110 CDD:468478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..112
CLECT_collectin_like 151..266 CDD:153061 35/117 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.