DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Clec4e

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001005897.2 Gene:Clec4e / 450223 RGDID:1359298 Length:215 Species:Rattus norvegicus


Alignment Length:115 Identity:30/115 - (26%)
Similarity:49/115 - (42%) Gaps:18/115 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 WTSALSACQKMGGNLASIIN---EADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFL 222
            |.|:|:.|..||.:|. :||   |.:|  :.....:...:.||::|...:|.:..|..   .||.
  Rat   102 WPSSLNNCSDMGAHLV-VINTWEEQEF--LFRTKPRKKEFYIGLTDQVVEGQWRWVDD---TPFT 160

  Fly   223 K----WNPGEPLYEHVDQRCVSIHNGG----MW-VASCTSDFKYICEANE 263
            :    |:.|||......:.|.::.:..    .| ..||.....:|||..|
  Rat   161 ESLSFWDAGEPNNIVFVEDCATMRDSSNPRKNWNDVSCFFSMPWICEMPE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474
CLECT 160..260 CDD:153057 27/110 (25%)
Clec4eNP_001005897.2 CLECT_DC-SIGN_like 81..208 CDD:153060 28/111 (25%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000250|UniProtKB:Q9ULY5 170..172 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.