DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Clec4b2

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004159.1 Gene:Clec4b2 / 381809 MGIID:3588267 Length:208 Species:Mus musculus


Alignment Length:99 Identity:25/99 - (25%)
Similarity:46/99 - (46%) Gaps:10/99 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 CQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLA-EKGVFISVSS-GKRAPFLKWNPGEPL 230
            |...|.:|..|.::.:.:.|...|.....|.||:||:. .:..:|..:. ..||.|  |:.|||.
Mouse   108 CSLRGAHLVVIHSQEEQDFITRMLDTAAGYFIGLSDVGNSQWRWIDQTPYNDRATF--WHKGEPN 170

  Fly   231 YEHVDQRCVSI-HNGGMW---VASCTSDFKYICE 260
            .::  ::||.: :...||   ...|:.:...:|:
Mouse   171 NDY--EKCVILNYRKTMWGWNDIDCSDEENSVCQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474
CLECT 160..260 CDD:153057 24/97 (25%)
Clec4b2NP_001004159.1 CLECT_DC-SIGN_like 79..203 CDD:153060 25/99 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.