DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Acp29AB

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_523512.2 Gene:Acp29AB / 34162 FlyBaseID:FBgn0015583 Length:234 Species:Drosophila melanogaster


Alignment Length:214 Identity:60/214 - (28%)
Similarity:101/214 - (47%) Gaps:26/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 IGHIAQHQEQWKTCKLQEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQLS 117
            |..|..:|..|.|                    ..:|.::....|.:.:|.|...|.|:.:.|:.
  Fly    42 IDQIGINQNYWFT--------------------YNALKQNETLAIIDTMEMRIASSLLEFKAQME 86

  Fly   118 -DLQEALTSITTSLKNMSAKINI-LHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIIN 180
             .||.....:.....|:.|..|| :.||:::|||:.|||..:.|.|..|...|:||.|:||:|.:
  Fly    87 IQLQPLKIIMRHHASNIKASNNIKMRRFEKVGSRHFHIEKNLMQTWFEAYVTCRKMNGHLANIQD 151

  Fly   181 EADFNAIVSQLSKDNTYMIGISDLAEK-GVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSIHNG 244
            |.:.:.|:: |:.:|:|.|.||.|.|. |.|:|..:|:...|:||...:...:  ..:||.|:..
  Fly   152 EMELDGILA-LAPNNSYWIDISKLVENGGTFVSTLTGREPFFVKWKSNQDTKK--KNQCVYIYAK 213

  Fly   245 GMWVASCTSDFKYICEANE 263
            .|....|.....::|:|::
  Fly   214 EMSYDECFEKKSFVCQADQ 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 15/81 (19%)
CLECT 160..260 CDD:153057 31/100 (31%)
Acp29ABNP_523512.2 CLECT 121..229 CDD:214480 35/110 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D112956at50557
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.