DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Colec10

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:157 Identity:41/157 - (26%)
Similarity:75/157 - (47%) Gaps:18/157 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQ--NWTSALSACQKMGG 173
            |:.||| |:  ::..:.||:|.:.   |::...:....::.:   |||:  |:..:|:.|:..||
  Rat   126 KVVGQL-DI--SVARLKTSMKFIK---NVIAGIRETEEKFYY---IVQEEKNYRESLTHCRIRGG 181

  Fly   174 NLASIINEADFNAIVSQLSKDNTY--MIGISDLAEKGVFISVSSGKRAPFLKWNPGEPL--YEHV 234
            .||...:|.....|...::|...:  .||::||.::|.::...:.....:..|..|||.  |.|.
  Rat   182 MLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVFTDNTPLQNYSNWKEGEPSDPYGHE 246

  Fly   235 DQRCVSIHNGGMW-VASCTSDFKYICE 260
            |  ||.:.:.|.| ...|.....::||
  Rat   247 D--CVEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 8/22 (36%)
CLECT 160..260 CDD:153057 27/104 (26%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 32/120 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5161
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.