DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Colec10

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:157 Identity:41/157 - (26%)
Similarity:75/157 - (47%) Gaps:18/157 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KMEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQ--NWTSALSACQKMGG 173
            |:.||| |:  ::..:.||:|.:.   |::...:....::.:   |||:  |:..:|:.|:..||
  Rat   126 KVVGQL-DI--SVARLKTSMKFIK---NVIAGIRETEEKFYY---IVQEEKNYRESLTHCRIRGG 181

  Fly   174 NLASIINEADFNAIVSQLSKDNTY--MIGISDLAEKGVFISVSSGKRAPFLKWNPGEPL--YEHV 234
            .||...:|.....|...::|...:  .||::||.::|.::...:.....:..|..|||.  |.|.
  Rat   182 MLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVFTDNTPLQNYSNWKEGEPSDPYGHE 246

  Fly   235 DQRCVSIHNGGMW-VASCTSDFKYICE 260
            |  ||.:.:.|.| ...|.....::||
  Rat   247 D--CVEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474 12/50 (24%)
CLECT 160..260 CDD:153057 27/104 (26%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 32/120 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.