DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Mbl1

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:162 Identity:42/162 - (25%)
Similarity:78/162 - (48%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 EGQLSDLQEALTSITTSLKNMSAKINI----------LHRF---KRIGSRYLHIEDIVQQNWTSA 164
            :||..|..:: .:|...|.||.|:||.          ||.|   |:.|.::. :.:..:..::..
  Rat    79 KGQKGDRGDS
-RAIEVKLANMEAEINTLKSKLELTNKLHAFSMGKKSGKKFF-VTNHERMPFSKV 141

  Fly   165 LSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEP 229
            .:.|.::.|.:| |...|:.|..:.:::|.:.: :||:|...:|.|:.|:.| |..:..|...||
  Rat   142 KALCSELRGTVA-IPRNAEENKAIQEVAKTSAF-LGITDEVTEGQFMYVTGG-RLTYSNWKKDEP 203

  Fly   230 LYEHVDQRCVSIHNGGMW-VASCTSDFKYICE 260
            ......:.||:|.:.|:| ..||.:....:||
  Rat   204 NDHGSGEDCVTIVDNGLWNDISCQASHTAVCE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 6/20 (30%)
CLECT 160..260 CDD:153057 25/100 (25%)
Mbl1NP_036731.2 Collagen 36..>88 CDD:189968 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87 3/7 (43%)
CLECT_collectin_like 126..236 CDD:153061 27/114 (24%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 2/7 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11575
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.