DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Mgl2

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_006532975.1 Gene:Mgl2 / 216864 MGIID:2385729 Length:381 Species:Mus musculus


Alignment Length:247 Identity:52/247 - (21%)
Similarity:100/247 - (40%) Gaps:65/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQLSDLQEALTSITTSLKNM 133
            ||:|| .||:.:::.|.:::| |..::.:..|:.:.|:..:     ||....:|||....:|||.
Mouse   126 QELQA-GRDLSQKVTSLESTL-EKREQALKTDLSDLTDHVQ-----QLETDLKALTCQLANLKNN 183

  Fly   134 SAKINI--LHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQLSKDNT 196
            .:::..  ||..:..||.|...|.  :::|..|...|:....:|..:.:..:.|.:.::|:...:
Mouse   184 GSEVACCPLHWTEHEGSCYWFSES--EKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLS 246

  Fly   197 YMIGISDL-----------AEKG-----------VFISVS---------------SGKRAP---- 220
            :| |::|.           .:||           :::.:|               ||..|.    
Mouse   247 WM-GLTDQNGPWRWVDGTDFDKGFKYVCRLQLAPLYLGLSYLFSIFSDPRDLGGPSGNMADGQIW 310

  Fly   221 ------FLKWNPGEP--LYEHV---DQRCVSIHNGGMWVAS-CTSDFKYICE 260
                  |..|.|.:|  .:.|:   .:.|......|.|... |...:.:|||
Mouse   311 SAQFFIFRNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWNDDVCQRHYHWICE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 19/64 (30%)
CLECT 160..260 CDD:153057 25/152 (16%)
Mgl2XP_006532975.1 Lectin_N 39..180 CDD:367741 16/60 (27%)
CLECT_DC-SIGN_like 190..363 CDD:153060 33/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.