Sequence 1: | NP_001285727.1 | Gene: | lectin-28C / 53542 | FlyBaseID: | FBgn0040099 | Length: | 265 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006532975.1 | Gene: | Mgl2 / 216864 | MGIID: | 2385729 | Length: | 381 | Species: | Mus musculus |
Alignment Length: | 247 | Identity: | 52/247 - (21%) |
---|---|---|---|
Similarity: | 100/247 - (40%) | Gaps: | 65/247 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 QEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQLSDLQEALTSITTSLKNM 133
Fly 134 SAKINI--LHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQLSKDNT 196
Fly 197 YMIGISDL-----------AEKG-----------VFISVS---------------SGKRAP---- 220
Fly 221 ------FLKWNPGEP--LYEHV---DQRCVSIHNGGMWVAS-CTSDFKYICE 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-28C | NP_001285727.1 | Mer2 | <12..134 | CDD:286200 | 19/64 (30%) |
CLECT | 160..260 | CDD:153057 | 25/152 (16%) | ||
Mgl2 | XP_006532975.1 | Lectin_N | 39..180 | CDD:367741 | 16/60 (27%) |
CLECT_DC-SIGN_like | 190..363 | CDD:153060 | 33/176 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |