DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Sftpa1

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_075623.2 Gene:Sftpa1 / 20387 MGIID:109518 Length:248 Species:Mus musculus


Alignment Length:145 Identity:36/145 - (24%)
Similarity:58/145 - (40%) Gaps:5/145 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEA 182
            :||.||..|...:......:::......:|.:...... ...|:.:....|.:.||::|:..|..
Mouse   106 ELQTALYEIKHQILQTMGVLSLQGSMLSVGDKVFSTNG-QSVNFDTIREMCTRAGGHIAAPRNPE 169

  Fly   183 DFNAIVSQLSKDNTY-MIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYEHVDQRCVSIHNGGM 246
            :..||.|...|.||| .:|:.:....|.| ....|....:..|.|||| .....::||.::..|.
Mouse   170 ENEAIASITKKYNTYPYLGVIEGQTPGDF-HYLDGASVNYTNWYPGEP-RGRGKEKCVEMYTDGK 232

  Fly   247 W-VASCTSDFKYICE 260
            | ...|......|||
Mouse   233 WNDKGCLQYRLAICE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 5/15 (33%)
CLECT 160..260 CDD:153057 28/101 (28%)
Sftpa1NP_075623.2 Collagen 27..98 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..100
CLECT_collectin_like 136..248 CDD:153061 30/115 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8166
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.