DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Clec10a

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001191181.1 Gene:Clec10a / 17312 MGIID:96975 Length:305 Species:Mus musculus


Alignment Length:291 Identity:62/291 - (21%)
Similarity:117/291 - (40%) Gaps:62/291 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFQLKVLLYYAIIAIVINASPSGCEE------------TDRVVCQLEDPRNQCGPFCLEALMPLI 53
            :|.|.:.|...::..||.:..|....            |.::..:.:...::...| .:.:..|.
Mouse    39 LFSLGLSLLLLVVVSVIGSQNSQLRRDLGTLRATLDNTTSKIKAEFQSLDSRADSF-EKGISSLK 102

  Fly    54 GHIAQHQEQWKTCKLQEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSELKMEGQLSD 118
            ..:..|:        ||:|| .||:.:::.|.: |..|..::.:..|:.:.|:..:     ||..
Mouse   103 VDVEDHR--------QELQA-GRDLSQKVTSLE-STVEKREQALKTDLSDLTDHVQ-----QLRK 152

  Fly   119 LQEALTSITTSLKNMSAKINI--LHRFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINE 181
            ..:|||....:|||..:::..  ||..:..||.|...|.  :::|..|...|:....:|..:.:.
Mouse   153 DLKALTCQLANLKNNGSEVACCPLHWTEHEGSCYWFSES--EKSWPEADKYCRLENSHLVVVNSL 215

  Fly   182 ADFNAIVSQLSKDNTYMIGISDL-----------AEKGVFISVSSGKRAPFLKWNPGEP--LYEH 233
            .:.|.:.::|:...:: ||::|.           .|||            |..|.|.:|  .:.|
Mouse   216 EEQNFLQNRLANVVSW-IGLTDQNGPWRWVDGTDFEKG------------FKNWAPLQPDNWFGH 267

  Fly   234 ---VDQRCVSIHNGGMWVAS-CTSDFKYICE 260
               ..:.|..|..||.|... |...|::|||
Mouse   268 GLGGGEDCAHITTGGPWNDDVCQRTFRWICE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 26/133 (20%)
CLECT 160..260 CDD:153057 25/116 (22%)
Clec10aNP_001191181.1 Lectin_N 14..164 CDD:281887 26/140 (19%)
CLECT_DC-SIGN_like 174..299 CDD:153060 33/140 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.