DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and clec-53

DIOPT Version :10

Sequence 1:NP_652636.2 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_491247.2 Gene:clec-53 / 171967 WormBaseID:WBGene00020191 Length:308 Species:Caenorhabditis elegans


Alignment Length:123 Identity:33/123 - (26%)
Similarity:48/123 - (39%) Gaps:28/123 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 NWTSALSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISV----------- 213
            |:.:|.|.|..:.|:|.||.|..| ||.||  |:...||.|       |.:|..           
 Worm    42 NFQTAESICATLSGHLVSIHNAID-NAFVS--SQAQKYMDG-------GAWIGAQASAPDVTNPL 96

  Fly   214 ----SSGKRAPFLKWNPGEPLYEHVDQRCVSIHNG-GMW-VASCTSDFKYICEANENV 265
                :.|....:..:..|:|. ......|:.:..| ..| .|:||:...:||.|...|
 Worm    97 NWYWTDGSNFDYQNYKVGQPT-PPGSTACMQLETGTAKWQTANCTNKLPFICSAAATV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_652636.2 SMC_N <20..>160 CDD:481474 33/123 (27%)
CLECT 160..260 CDD:153057 30/116 (26%)
clec-53NP_491247.2 CLECT 32..147 CDD:153057 29/115 (25%)
CLECT 166..303 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.