DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Mbl2

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:162 Identity:38/162 - (23%)
Similarity:81/162 - (50%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 NRTNRSELKMEGQLSDLQEALTSITTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTSALSA 167
            :|.:|:|.    ..|::...:.::.:.|:.:...: :....:::|.:|. :..:.:.:.....:.
Mouse    92 DRGDRAEF----DT
SEIDSEIAALRSELRALRNWV-LFSLSEKVGKKYF-VSSVKKMSLDRVKAL 150

  Fly   168 CQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGEPLYE 232
            |.:..|::|:..| |:.|:.:.:::||..| :||:|:..:|.|..: :|.|..:..||.|||...
Mouse   151 CSEFQGSVATPRN-AEENSAIQKVAKDIAY-LGITDVRVEGSFEDL-TGNRVRYTNWNDGEPNNT 212

  Fly   233 HVDQRCVSIHNGGMW-VASCTSDFKYICEANE 263
            ...:.||.|...|.| ...|:..|..|||.::
Mouse   213 GDGEDCVVILGNGKWNDVPCSDSFLAICEFSD 244

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 5/30 (17%)
CLECT 160..260 CDD:153057 29/100 (29%)