DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and Asgr1

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001278060.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:244 Identity:50/244 - (20%)
Similarity:92/244 - (37%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVCQLEDPRNQCGPFCLEALMPLIGHIAQHQEQWKTCKLQ--EIQAQQRDIEKEIESQKTSLTES 92
            |||.:....:|.....|.............::|.|....|  .:..:.:.:|.::|.|:..|||.
Mouse    54 VVCVITSQNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTED 118

  Fly    93 WKKIIAEDIENRTNRSELKMEGQLSDLQEALTSITTSLKNMSAK----INILHRFKRIGSRYLHI 153
            ...::            |.::..:||::.....:.....|.|.:    ||.:   :..||.|...
Mouse   119 HSSLL------------LHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWV---EYEGSCYWFS 168

  Fly   154 EDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISV-SSGK 217
            ..:  :.||.|...||....:|..:.:..:.|.:...:...||: ||::|  :.|.:..| .:..
Mouse   169 SSV--RPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTW-IGLTD--QNGPWKWVDGTDY 228

  Fly   218 RAPFLKWNPGEP--LYEH---VDQRCVSIHNGGMWVAS-CTSDFKYICE 260
            ...|..|.|.:|  .|.|   ..:.|......|.|... |...::::||
Mouse   229 ETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 18/105 (17%)
CLECT 160..260 CDD:153057 24/106 (23%)
Asgr1NP_001278060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859 17/100 (17%)
CLECT_DC-SIGN_like 153..278 CDD:153060 31/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.