DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-28C and mrc1

DIOPT Version :9

Sequence 1:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_012821081.2 Gene:mrc1 / 100493504 XenbaseID:XB-GENE-494275 Length:1450 Species:Xenopus tropicalis


Alignment Length:258 Identity:63/258 - (24%)
Similarity:102/258 - (39%) Gaps:74/258 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EQWKTCKLQEIQAQQRDIEKE--------------------IESQKT----SLTESWK----KII 97
            |.|:.||.::  ::...|..|                    :.|.||    ..|::||    |..
 Frog  1114 EAWRKCKSED--SELVSITDEYTNSFLRVYTSKYREPFWIGLNSNKTGNQYKWTDNWKLRYTKWA 1176

  Fly    98 AEDIENRTNRSELKMEGQ--LSDLQEALTSITTSLKNMSA-------------------KINILH 141
            ||:.:..|....:.::||  .|...|...||   .|...|                   :..|..
 Frog  1177 AEEPKKTTACVYMDIDGQWKTSSCTENYFSI---CKQSDAIAPTDPPQKPGKCPPDSDDRSWIPF 1238

  Fly   142 RFKRIGSRYLHIEDIVQQNWTSALSACQKMGGNLASIINEADFNAIVSQL----SKDNTYMIGI- 201
            |    |..|| |:....:||..|...|.:.||:|||..:..:.|.:..|:    .:..::.||: 
 Frog  1239 R----GHCYL-IQVSYTKNWYQASLECLRFGGSLASFDDSLESNFVWHQIERLEDRVKSFWIGMY 1298

  Fly   202 SDLAEKGVFISVSSGKRAP--FLKWNPGEPLYEHVDQRCVSIHNG-GMW-VASCTSDFKYICE 260
            .::..|.:::.     .||  |:.||.||| .:|.|:.||.:::. |.| ...|:|...|||:
 Frog  1299 QNVENKWLWLD-----NAPVDFVNWNIGEP-SDHNDEHCVEMYSSHGTWNNLYCSSYRGYICK 1355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 23/102 (23%)
CLECT 160..260 CDD:153057 32/108 (30%)
mrc1XP_012821081.2 RICIN 26..140 CDD:214672
FN2 159..207 CDD:128373
CLECT 227..339 CDD:153057
CLECT 359..483 CDD:214480
CLECT 501..623 CDD:214480
CLECT 643..775 CDD:413318
CLECT 799..920 CDD:214480
CLECT 941..1076 CDD:214480
CLECT 1095..1209 CDD:214480 22/99 (22%)
CLECT 1226..1355 CDD:214480 38/139 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.