DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-28C and mrc1a

DIOPT Version :9

Sequence 1:	NP_001285727.1	Gene:	lectin-28C / 53542	FlyBaseID:	FBgn0040099	Length:	265	Species:	Drosophila melanogaster
Sequence 2:	XP_002663014.2	Gene:	mrc1a / 100286774	ZFINID:	ZDB-GENE-090915-4	Length:	1440	Species:	Danio rerio

Alignment Length:	108	Identity:	38/108 - (35%)
Similarity:	51/108 - (47%)	Gaps:	12/108 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   161 WTSALSACQKMGGNLASIINEADFNAIVSQ---LSKDNTYMIGISDLAEKGVFISVSSGKRAPFL 222
            |..||:||.:.|.|||||.|..:.:.|:||   |..|..: ||::|...:.:| ..|......|.
Zfish   382 WNDALAACHREGANLASIHNIEEHSFIISQSGYLPTDELW-IGLNDQKTQNLF-EWSDRTHVTFT 444

  Fly   223 KWNPGEPLYEHVDQR---CVSIH-NGGMWV-ASCTSDFKYICE 260
            .|..|||  .|...|   ||.|. ..|.|. .:|..:..|||:
Zfish   445 TWLVGEP--SHFINRLEDCVLIKGKDGKWADHACEMERGYICK 485

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-28C	NP_001285727.1	Mer2	<12..134	CDD:286200
lectin-28C	NP_001285727.1	CLECT	160..260	CDD:153057	37/106 (35%)
mrc1a	XP_002663014.2	RICIN	31..>108	CDD:214672
		RICIN	37..>108	CDD:238092
		FN2	165..213	CDD:128373
		CLECT	235..343	CDD:153057
		CLECT	361..485	CDD:214480	37/106 (35%)
		CLECT	503..625	CDD:214480
		CLECT	656..771	CDD:153057
		CLECT	794..914	CDD:214480
		CLECT	944..1072	CDD:153057
		CLECT	1087..1204	CDD:214480
		CLECT	1221..1347	CDD:214480
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910