DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-30A and Klri2

DIOPT Version :10

Sequence 1:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_796129.2 Gene:Klri2 / 320407 MGIID:2443965 Length:248 Species:Mus musculus


Alignment Length:118 Identity:23/118 - (19%)
Similarity:44/118 - (37%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GTRRFYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFSRAPAGVFWI--DMNAMFKNGLF 171
            |...:.:.:||.:.|..:.:.|.:|..|:..|..:.|...:......|  ||  .|:....:.|:
Mouse   140 GNNFYCVFRENSKTWVESQSACEELNSHLVIIDSKAEVENLLLFEMDG--WILHRMDGTNSSRLW 202

  Fly   172 ASSLTGRSPPFFKWKKEE------RGNKFDCVNVYNKEMYNENCFNTHLFICQ 218
            .:.:..|:......:|:.      |||.|          ..:.|.....:||:
Mouse   203 GNDIKIRNTLMNDSEKKNHSCHYLRGNIF----------MPDECSAKKTYICE 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 21/107 (20%)
Klri2NP_796129.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..44
CLECT_NK_receptors_like 132..245 CDD:153063 22/116 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.