DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and asgrl3

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_021332405.1 Gene:asgrl3 / 799269 ZFINID:ZDB-GENE-060526-152 Length:311 Species:Danio rerio


Alignment Length:150 Identity:38/150 - (25%)
Similarity:62/150 - (41%) Gaps:14/150 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKG---LNLADVSTMEDFKAVVH 82
            :.|.:|.:.| |...........|:.....|:||..|::.|..||   |.:.|.|..|..:....
Zfish   164 EHSSEELESG-CSDSAWVPFGNSCYLFSRDKMNWTEAKDYCEEKGAWLLKIEDDSEDEWVRNECQ 227

  Fly    83 YVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLV---RYMGDSNIVEPTQRS---NLDDCLEIRIR 141
            :||.......:|.|..| |:.|::::.......   .:.|.....|.|:.|   ..:||.||...
Zfish   228 FVTDFANPTHYWIGLTD-QNTGQWRWADGTNYTMNKEHWGPGQPDEWTEHSLGEEGEDCAEITYE 291

  Fly   142 PNVTVVLDVNCQEKKYFICE 161
               :::.|::|..|..||||
Zfish   292 ---SLLNDLHCSSKIKFICE 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 33/127 (26%)
asgrl3XP_021332405.1 CLECT_DC-SIGN_like 179..309 CDD:153060 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.