DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and lectin-22C

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:139 Identity:35/139 - (25%)
Similarity:58/139 - (41%) Gaps:26/139 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YL--RELNGKCFYV-GIKKINWFGAQNNCLRKGLNLADVSTMEDFKAV-------VHYVTSQVGF 90
            ||  .::..|.:|: .:.:.||..|...|...|.:|||:....|..|:       .||       
  Fly   136 YLGFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADIKDEADLAAIKANLKEDTHY------- 193

  Fly    91 DDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEK 155
               |.|.|||..||:|..:.:||...::..:: ..|:|...| :|:.:....    :.|..|...
  Fly   194 ---WLGINDLDHEGKFLSMPTGKQTTFLKWAS-GRPSQLDTL-NCVFLYNGE----MYDYPCHYT 249

  Fly   156 KYFICEQNQ 164
            ..|||:..:
  Fly   250 FRFICQTEE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 33/126 (26%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.