DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4a3

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001191170.1 Gene:Clec4a3 / 73149 MGIID:1920399 Length:237 Species:Mus musculus


Alignment Length:177 Identity:33/177 - (18%)
Similarity:64/177 - (36%) Gaps:35/177 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILTLMTVHS-----------------GCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKI-NW 54
            ::||.|.:|                 .|.|..|..|.....|.....:.....|::.....: :|
Mouse    65 LITLFTKYSQLLEEKMIIKELNYTELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASW 129

  Fly    55 FGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMG 119
            ..::.||...|.:|..:.:.|:    ..::|..:.....:|.|.....:.::::|.....     
Mouse   130 NESKENCFHMGAHLVVIHSQEE----QDFITGILDTGTAYFIGLSNPGDQQWQWIDQTPY----- 185

  Fly   120 DSNIV-----EPTQRSNLDDCLEIRIRPNV-TVVLDVNCQEKKYFIC 160
            |.|..     ||:  |:.:.|:.|..|.:. ....|:.|.:|:..||
Mouse   186 DDNTTFWHKGEPS--SDNEQCVIINHRQSTGWGWSDIPCSDKQNSIC 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 24/125 (19%)
Clec4a3NP_001191170.1 DUF2418 41..>82 CDD:287321 4/16 (25%)
CLECT_DC-SIGN_like 107..230 CDD:153060 22/133 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.