DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd209g

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_006508948.1 Gene:Cd209g / 70192 MGIID:1917442 Length:295 Species:Mus musculus


Alignment Length:147 Identity:34/147 - (23%)
Similarity:62/147 - (42%) Gaps:30/147 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PCGKPYLREL-NGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTM--EDFKAVVHYVTSQVGFDD 92
            ||  |:..|| .|.|:.......:|..:.::|...|.:|..|:::  :.|....|...:|:    
Mouse   166 PC--PWDWELFQGSCYLFSRTLGSWETSASSCEDLGAHLVIVNSVSEQQFLKYWHIRKNQL---- 224

  Fly    93 FWFGGNDLQSEGRFKYISSGKL-VRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVL------DV 150
            .|.|.:|.:|||.::::....| :.:..:.   ||....: :||          ||:      |.
Mouse   225 TWIGLSDHRSEGSWQWVDDTPLKLSFWKEG---EPNNEGD-EDC----------VVMAEDKWNDS 275

  Fly   151 NCQEKKYFICEQNQMKC 167
            .|....:::|||....|
Mouse   276 RCTANNFWVCEQPSAPC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 25/127 (20%)
Cd209gXP_006508948.1 CLECT_DC-SIGN_like 167..286 CDD:153060 29/138 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.