DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec4b1

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001177239.1 Gene:Clec4b1 / 69810 MGIID:1917060 Length:209 Species:Mus musculus


Alignment Length:161 Identity:29/161 - (18%)
Similarity:54/161 - (33%) Gaps:59/161 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVG--IKKINWFGAQNNCLRKGLNLADVSTMEDFKAV-----VHYV----- 84
            |.|.: :.....|:.|.  ....:|..::.||.|.|.:|..:.:.|:...:     :|..     
Mouse    78 CPKDW-KLFGSHCYLVPTVFSSASWNKSEENCSRMGAHLVVIHSQEEQDFITGILDIHAAYFIGL 141

  Fly    85 ----------TSQVGFDD---FWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCL 136
                      ..|..:::   ||..|                           ||:  |:.:.|:
Mouse   142 WDTGHRQWQWVDQTPYEESVTFWHNG---------------------------EPS--SDNEKCV 177

  Fly   137 EIRIRPNVTVVL-DVNCQEKKYFICEQNQMK 166
            .:..|.|:.... |::|..|:..:|   |||
Mouse   178 TVYYRRNIGWGWNDISCNLKQKSVC---QMK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 24/144 (17%)
Clec4b1NP_001177239.1 CLECT_DC-SIGN_like 78..204 CDD:153060 26/158 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.