DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Cd209al3

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_038945829.1 Gene:Cd209al3 / 688858 RGDID:1584108 Length:207 Species:Rattus norvegicus


Alignment Length:200 Identity:49/200 - (24%)
Similarity:78/200 - (39%) Gaps:54/200 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRILPIVILT--LMTV--------HSGCGKKQSKKEKDKG--------PCGKPY-LRELNGKCFY 46
            :.:|.||:|.  |:||        .|...:|..|:....|        ||  |: ....:|:|:|
  Rat    28 LHLLSIVLLAGLLVTVLIQGFKDPSSSVNEKIYKQLMQLGIGVDSLCRPC--PWEWTFFHGRCYY 90

  Fly    47 VGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDF-------WFGGNDLQSEG 104
            ....:.||..:...|......|..|.:.|:          |...|.|       |.|.:||:.|.
  Rat    91 FSKSQRNWNDSVAACQEVDAQLVTVESDEE----------QTFLDTFLKNKGPAWMGLSDLKQES 145

  Fly   105 RFKYISSGKLVRYMGDSNIV-----EPTQRSNLDDCLEIRIRP-NVTVVLDVNCQEKKYFICEQN 163
            .::::....|    .||...     ||..:.| :||.|:|... |     |..|..||::||::.
  Rat   146 TWQWVDGSPL----SDSFRKYWIKGEPNNQGN-EDCAELREDGWN-----DNKCDNKKFWICKKP 200

  Fly   164 QMKCA 168
            :..|:
  Rat   201 ETSCS 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 33/131 (25%)
Cd209al3XP_038945829.1 CLECT_DC-SIGN_like 77..199 CDD:153060 36/143 (25%)

Return to query results.
Submit another query.