DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Mbl2

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_073195.2 Gene:Mbl2 / 64668 RGDID:67380 Length:244 Species:Rattus norvegicus


Alignment Length:136 Identity:32/136 - (23%)
Similarity:53/136 - (38%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGG 97
            ||.|        |...::::....|:..|......:|.....|:.:|:.: |...|.|    .|.
  Rat   131 GKKY--------FMSSVRRMPLNRAKALCSELQGTVATPRNAEENRAIQN-VAKDVAF----LGI 182

  Fly    98 NDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLEIRIRPNVTVVL-------DVNCQEK 155
            .|.::|..|:.: :|..|||. :.|..||....:.::|          |||       ||.|.:.
  Rat   183 TDQRTENVFEDL-TGNRVRYT-NWNEGEPNNVGSGENC----------VVLLTNGKWNDVPCSDS 235

  Fly   156 KYFICE 161
            ...:||
  Rat   236 FLVVCE 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/126 (23%)
Mbl2NP_073195.2 Collagen 36..95 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..99
CLECT_collectin_like 132..242 CDD:153061 31/135 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.