DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec10a

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:147 Identity:32/147 - (21%)
Similarity:51/147 - (34%) Gaps:27/147 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFG 96
            |...:..|..|.|::.......|..|...|..:..||..|:::    |..:::.:.:|....|.|
  Rat   175 CCPLHWMEHEGSCYWFSQSGKPWPEADKYCQLENSNLVAVNSL----AEQNFLQTHMGSVVTWIG 235

  Fly    97 GNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNL--------DDCLEIRI--RPNVTVVLDVN 151
            ..|  ..|.::::..   ..|........|.|..|.        :||.....  |.|     |..
  Rat   236 LTD--QNGPWRWVDG---TDYEKGFTHWAPKQPDNWYGHGLGGGEDCAHFTSDGRWN-----DDV 290

  Fly   152 CQEKKYFICEQNQMKCA 168
            ||....::||   ||.|
  Rat   291 CQRPYRWVCE---MKLA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 25/128 (20%)
Clec10aXP_008766090.1 Lectin_N 5..166 CDD:461106
CLECT_DC-SIGN_like 176..301 CDD:153060 28/141 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.