DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and Clec10a

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:147 Identity:32/147 - (21%)
Similarity:51/147 - (34%) Gaps:27/147 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 CGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFG 96
            |...:..|..|.|::.......|..|...|..:..||..|:::    |..:::.:.:|....|.|
  Rat   175 CCPLHWMEHEGSCYWFSQSGKPWPEADKYCQLENSNLVAVNSL----AEQNFLQTHMGSVVTWIG 235

  Fly    97 GNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNL--------DDCLEIRI--RPNVTVVLDVN 151
            ..|  ..|.::::..   ..|........|.|..|.        :||.....  |.|     |..
  Rat   236 LTD--QNGPWRWVDG---TDYEKGFTHWAPKQPDNWYGHGLGGGEDCAHFTSDGRWN-----DDV 290

  Fly   152 CQEKKYFICEQNQMKCA 168
            ||....::||   ||.|
  Rat   291 CQRPYRWVCE---MKLA 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 25/128 (20%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887
Apolipoprotein <63..166 CDD:279749
CLECT_DC-SIGN_like 176..301 CDD:153060 28/141 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.