DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and si:dkey-9i23.4

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001139080.1 Gene:si:dkey-9i23.4 / 571855 ZFINID:ZDB-GENE-090313-363 Length:189 Species:Danio rerio


Alignment Length:165 Identity:36/165 - (21%)
Similarity:64/165 - (38%) Gaps:35/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HSGCGKKQSKKEKDKGPCGKPYLRELNG--KCFYVGIKKINWFGAQNN-------CLRKG--LNL 68
            |:| |...::|      |..|...::.|  ..|.||.:.:.:|.::.|       |..|.  .:|
Zfish    28 HAG-GVNATEK------CSMPKACDVPGFSDWFRVGQRCVKYFSSRLNFTEAEFSCRTKAPRAHL 85

  Fly    69 ADVSTMEDFKAVVHYVTSQVGFDD----FWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQR 129
            ..|...:|...::..|..   |:.    .|.|..:|...|.|.::...     ..:.|...|.:.
Zfish    86 VSVHNSQDNSNLLCIVKK---FNPKSLRIWLGAYELFQSGEFFWLDGS-----FWNFNQWVPGEP 142

  Fly   130 SNL----DDCLEIRIRPNVTVVLDVNCQEKKYFIC 160
            :::    ::|:|:..| .:....|..|..||.|||
Zfish   143 NHMYTYTEECVEMNWR-EIGKWNDATCSVKKSFIC 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/135 (21%)
si:dkey-9i23.4NP_001139080.1 CLECT 58..176 CDD:153057 24/126 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.