DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and si:dkey-241l7.3

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:XP_021324414.1 Gene:si:dkey-241l7.3 / 567766 ZFINID:ZDB-GENE-041014-239 Length:162 Species:Danio rerio


Alignment Length:133 Identity:36/133 - (27%)
Similarity:55/133 - (41%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILTLMTVHSGCGKKQSKKEKDKGPCGKPYLRELNGKCFYVGIKKINWFGAQNNCLRKGLNLADV- 71
            :|.|..|.|..|..:.:...::|..|.      ..:||....:.:||..|:.||...|.|||.| 
Zfish     8 LLLLSIVFSMEGADEERLRCERGWSGS------GSRCFRFFSRSVNWVTAERNCQSLGGNLASVH 66

  Fly    72 -STMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDC 135
             ....||     .:|...|....|.||:|.:.:|::.: |.|.:..|   :|..........:.|
Zfish    67 DQVENDF-----LLTLVPGSTRCWIGGHDGEQDGQWLW-SDGSVYGY---TNWCSGEPSGGSEHC 122

  Fly   136 LEI 138
            |||
Zfish   123 LEI 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 29/98 (30%)
si:dkey-241l7.3XP_021324414.1 CLECT 27..126 CDD:214480 31/114 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.