DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and si:ch211-125e6.13

DIOPT Version :10

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001153806.1 Gene:si:ch211-125e6.13 / 566620 ZFINID:ZDB-GENE-070912-37 Length:151 Species:Danio rerio


Alignment Length:135 Identity:34/135 - (25%)
Similarity:55/135 - (40%) Gaps:16/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RELNGKCFYVGIKKINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQS 102
            |....:||.:....:||..|:.||.|.|.|||.|....:...::..:.:.   ..|:.||.::..
Zfish    29 RRSGSRCFRLFSTSVNWATAEKNCQRLGGNLASVLNDVENDFLLSLIPNS---KRFFIGGYNVDE 90

  Fly   103 EGRFKYISSGKLVRY----MGDSNIVEPTQRSNLDDCLEIRIRPNVTVVLDVNCQEKKYFICEQN 163
            :..|  .|.|....|    .|:.|      ..|.:.||||....| ....::.|..:..:||.:|
Zfish    91 QNWF--WSDGSPFGYTNWCSGEPN------NMNTEHCLEINWTAN-RCWNNLPCSVELGYICAKN 146

  Fly   164 QMKCA 168
            ...|:
Zfish   147 LNDCS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 31/122 (25%)
si:ch211-125e6.13NP_001153806.1 CLECT 34..145 CDD:153057 31/122 (25%)

Return to query results.
Submit another query.