DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-46Ca and zgc:174904

DIOPT Version :9

Sequence 1:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster
Sequence 2:NP_001170922.1 Gene:zgc:174904 / 564690 ZFINID:ZDB-GENE-080204-76 Length:320 Species:Danio rerio


Alignment Length:179 Identity:38/179 - (21%)
Similarity:73/179 - (40%) Gaps:41/179 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KKQSKKEKDK-------------------------------GPCGKPYLRELNGKCFYVGIKKIN 53
            |::|:.||:|                               .||.:.: :..||.|:::.:...:
Zfish   143 KRKSELEKEKSELQKELLQLKDKVTKCEVTPAPRTTPAPTTSPCPQNW-KHFNGSCYFISVTTRS 206

  Fly    54 WFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGNDLQSEGRFKYISSGKLVRYM 118
            |..:|..|.|.|.:||.:.|.|: :..:..:..:..::.||||.:|.:.|..:.::...|||...
Zfish   207 WTDSQTYCKRYGGHLAIILTAEE-QTFIWDLLPRGYWNAFWFGISDEKVEDDWHWVDGTKLVGGF 270

  Fly   119 GDSNIVEPTQRSNLDDC-----LEIRIRPNVTVVLDVNCQEKKYFICEQ 162
            .:..  ||....: :||     .::..|..:....|..|.....:|||:
Zfish   271 WEDG--EPNNHID-EDCGYMIKTDVLTRVAIKSWYDAPCHMSLPWICEK 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 28/123 (23%)
zgc:174904NP_001170922.1 CLECT_DC-SIGN_like 186..316 CDD:153060 31/134 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.